Lineage for d2avua_ (2avu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734954Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. 2734955Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. 2734956Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. 2734957Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. 2734958Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)
  8. 2734961Domain d2avua_: 2avu A: [127383]
    Other proteins in same PDB: d2avue1, d2avuf_
    automated match to d1g8ea_
    complexed with zn

Details for d2avua_

PDB Entry: 2avu (more details), 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription
PDB Compounds: (A:) Transcriptional activator flhD

SCOPe Domain Sequences for d2avua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avua_ a.145.1.1 (A:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

SCOPe Domain Coordinates for d2avua_:

Click to download the PDB-style file with coordinates for d2avua_.
(The format of our PDB-style files is described here.)

Timeline for d2avua_: