![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) ![]() |
![]() | Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins) Pfam PF01209 |
![]() | Protein Hypothetical methyltransferase TM1389 [142595] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142596] (1 PDB entry) Uniprot Q9X1A9 1-246 |
![]() | Domain d2avnb1: 2avn B:1-246 [127381] automatically matched to 2AVN A:1-246 complexed with po4, sai |
PDB Entry: 2avn (more details), 2.35 Å
SCOP Domain Sequences for d2avnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avnb1 c.66.1.41 (B:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} mklrswefydriaraydsmyetpkwklyhrligsfleeylknpcrvldlgggtgkwslfl qergfevvlvdpskemlevarekgvknvveakaedlpfpsgafeavlalgdvlsyvenkd kafseirrvlvpdglliatvdnfytflqqmiekdawdqitrflktqttsvgttlfsfnsy afkpedldslegfetvdirgigvmeypderisereetifrleqelsrdrniiwkadhiff vlkkkr
Timeline for d2avnb1: