Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.1: COMT-like [53336] (4 proteins) |
Protein automated matches [190251] (5 species) not a true protein |
Domain d2avdb_: 2avd B: [127378] Other proteins in same PDB: d2avda1 automated match to d2avda1 complexed with sam |
PDB Entry: 2avd (more details), 1.7 Å
SCOPe Domain Sequences for d2avdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avdb_ c.66.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcllppedsrlwqyllsrsmrehpalrslrlltleqpqgdsmmtceqaqllanlarliqa kkaldlgtftgysalalalalpadgrvvtcevdaqppelgrplwrqaeaehkidlrlkpa letldellaageagtfdvavvdadkencsayyerclqllrpggilavlrvlwrgkvlqpp kgdvaaecvrnlnerirrdvrvyisllplgdgltlafki
Timeline for d2avdb_: