Lineage for d2avdb_ (2avd B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145260Protein automated matches [190251] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188458] (1 PDB entry)
  8. 2145262Domain d2avdb_: 2avd B: [127378]
    Other proteins in same PDB: d2avda1
    automated match to d2avda1
    complexed with sam

Details for d2avdb_

PDB Entry: 2avd (more details), 1.7 Å

PDB Description: Crystal Structure of Human Catechol-O-methyltransferase domain containing 1
PDB Compounds: (B:) Catechol-O-methyltransferase

SCOPe Domain Sequences for d2avdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avdb_ c.66.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcllppedsrlwqyllsrsmrehpalrslrlltleqpqgdsmmtceqaqllanlarliqa
kkaldlgtftgysalalalalpadgrvvtcevdaqppelgrplwrqaeaehkidlrlkpa
letldellaageagtfdvavvdadkencsayyerclqllrpggilavlrvlwrgkvlqpp
kgdvaaecvrnlnerirrdvrvyisllplgdgltlafki

SCOPe Domain Coordinates for d2avdb_:

Click to download the PDB-style file with coordinates for d2avdb_.
(The format of our PDB-style files is described here.)

Timeline for d2avdb_: