Lineage for d2avdb1 (2avd B:44-262)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 704541Family c.66.1.1: COMT-like [53336] (3 proteins)
  6. 704559Protein COMT domain-containing protein 1, COMTD1 [142571] (1 species)
  7. 704560Species Human (Homo sapiens) [TaxId:9606] [142572] (1 PDB entry)
  8. 704562Domain d2avdb1: 2avd B:44-262 [127378]
    automatically matched to 2AVD A:44-262
    complexed with sam

Details for d2avdb1

PDB Entry: 2avd (more details), 1.7 Å

PDB Description: Crystal Structure of Human Catechol-O-methyltransferase domain containing 1
PDB Compounds: (B:) Catechol-O-methyltransferase

SCOP Domain Sequences for d2avdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avdb1 c.66.1.1 (B:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}
qcllppedsrlwqyllsrsmrehpalrslrlltleqpqgdsmmtceqaqllanlarliqa
kkaldlgtftgysalalalalpadgrvvtcevdaqppelgrplwrqaeaehkidlrlkpa
letldellaageagtfdvavvdadkencsayyerclqllrpggilavlrvlwrgkvlqpp
kgdvaaecvrnlnerirrdvrvyisllplgdgltlafki

SCOP Domain Coordinates for d2avdb1:

Click to download the PDB-style file with coordinates for d2avdb1.
(The format of our PDB-style files is described here.)

Timeline for d2avdb1: