Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) |
Family c.66.1.1: COMT-like [53336] (3 proteins) |
Protein COMT domain-containing protein 1, COMTD1 [142571] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142572] (1 PDB entry) |
Domain d2avdb1: 2avd B:44-262 [127378] automatically matched to 2AVD A:44-262 complexed with sam |
PDB Entry: 2avd (more details), 1.7 Å
SCOP Domain Sequences for d2avdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avdb1 c.66.1.1 (B:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} qcllppedsrlwqyllsrsmrehpalrslrlltleqpqgdsmmtceqaqllanlarliqa kkaldlgtftgysalalalalpadgrvvtcevdaqppelgrplwrqaeaehkidlrlkpa letldellaageagtfdvavvdadkencsayyerclqllrpggilavlrvlwrgkvlqpp kgdvaaecvrnlnerirrdvrvyisllplgdgltlafki
Timeline for d2avdb1: