Lineage for d2av9i1 (2av9 I:6-144)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858683Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 858684Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 858696Domain d2av9i1: 2av9 I:6-144 [127373]
    automatically matched to 2AV9 A:5-146
    complexed with so4

Details for d2av9i1

PDB Entry: 2av9 (more details), 2.4 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1.
PDB Compounds: (I:) thioesterase

SCOP Domain Sequences for d2av9i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av9i1 d.38.1.1 (I:6-144) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
srpvaipqelrdalaalqs

SCOP Domain Coordinates for d2av9i1:

Click to download the PDB-style file with coordinates for d2av9i1.
(The format of our PDB-style files is described here.)

Timeline for d2av9i1: