Lineage for d2av9h_ (2av9 H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901755Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1901861Protein automated matches [190155] (2 species)
    not a true protein
  7. 1901869Species Pseudomonas aeruginosa [TaxId:208964] [187318] (1 PDB entry)
  8. 1901876Domain d2av9h_: 2av9 H: [127372]
    Other proteins in same PDB: d2av9a1
    automated match to d2av9a1
    complexed with so4

Details for d2av9h_

PDB Entry: 2av9 (more details), 2.4 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1.
PDB Compounds: (H:) thioesterase

SCOPe Domain Sequences for d2av9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av9h_ d.38.1.1 (H:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
ssrpvaipqelrdalaalq

SCOPe Domain Coordinates for d2av9h_:

Click to download the PDB-style file with coordinates for d2av9h_.
(The format of our PDB-style files is described here.)

Timeline for d2av9h_: