SCOP 1.73: Domain d2av9h1: 2av9 H:5-143

Lineage for d2av9h1 (2av9 H:5-143)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (16 proteins)
   Pfam PF03061

6. Protein Hypothetical thioesterase PA5185 [143158] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143159] (1 PDB entry)

8. Domain d2av9h1: 2av9 H:5-143 [127372]
   automatically matched to 2AV9 A:5-146
   complexed with so4

Details for d2av9h1

PDB Entry: 2av9, 2.4 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1.

PDB Compounds: (H:) thioesterase

SCOP Domain Sequences for d2av9h1:

Sequence; same for both SEQRES and ATOM records:

>d2av9h1 d.38.1.1 (H:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
ssrpvaipqelrdalaalq

Timeline for d2av9h1:

• d2av9h1 is new in SCOP 1.73
  
• d2av9h1 appears in SCOP 1.75
  
• d2av9h1 appears in the current release, SCOPe 2.08, called d2av9h_