![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein automated matches [190155] (3 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187318] (1 PDB entry) |
![]() | Domain d2av9e_: 2av9 E: [127369] Other proteins in same PDB: d2av9a1 automated match to d2av9a1 complexed with so4 |
PDB Entry: 2av9 (more details), 2.4 Å
SCOPe Domain Sequences for d2av9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av9e_ d.38.1.1 (E:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} plreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvv ssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrss rpvaipqelrdalaalq
Timeline for d2av9e_: