Lineage for d2av9d_ (2av9 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943647Protein automated matches [190155] (3 species)
    not a true protein
  7. 2943670Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187318] (1 PDB entry)
  8. 2943673Domain d2av9d_: 2av9 D: [127368]
    Other proteins in same PDB: d2av9a1
    automated match to d2av9a1
    complexed with so4

Details for d2av9d_

PDB Entry: 2av9 (more details), 2.4 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1.
PDB Compounds: (D:) thioesterase

SCOPe Domain Sequences for d2av9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av9d_ d.38.1.1 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
taprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevi
glvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfve
rrssrpvaipqelrdalaalqs

SCOPe Domain Coordinates for d2av9d_:

Click to download the PDB-style file with coordinates for d2av9d_.
(The format of our PDB-style files is described here.)

Timeline for d2av9d_: