Lineage for d2av9b_ (2av9 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. Protein automated matches [190155] (3 species)
    not a true protein
  7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187318] (1 PDB entry)
  8. Domain d2av9b_: 2av9 B: [127366]
    Other proteins in same PDB: d2av9a1
    automated match to d2av9a1
    complexed with so4

Details for d2av9b_

PDB Entry: 2av9 (more details), 2.4 Å

PDB Description: Crystal Structure of the PA5185 protein from Pseudomonas Aeruginosa Strain PAO1.
PDB Compounds: (B:) thioesterase

SCOPe Domain Sequences for d2av9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av9b_ d.38.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
srpvaipqelrdalaalqs

SCOPe Domain Coordinates for d2av9b_ are not available.

Timeline for d2av9b_:

Domains from other chains:
(mouse over for more information)
d2av9a1, d2av9c_, d2av9d_, d2av9e_, d2av9f_, d2av9g_, d2av9h_, d2av9i_, d2av9j_, d2av9k_, d2av9l_