![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries) Uniprot P01892 25-298 |
![]() | Domain d2av7d2: 2av7 D:1-181 [127363] Other proteins in same PDB: d2av7a1, d2av7b2, d2av7b3, d2av7d1, d2av7e2, d2av7e3 automatically matched to d1akja2 complexed with gol; mutant |
PDB Entry: 2av7 (more details), 2.05 Å
SCOPe Domain Sequences for d2av7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av7d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetravkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2av7d2: