SCOPe 2.08: Domain d2av1d2: 2av1 D:1-181

Lineage for d2av1d2 (2av1 D:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d2av1d2: 2av1 D:1-181 [127353]
   Other proteins in same PDB: d2av1a1, d2av1b2, d2av1b3, d2av1d1, d2av1e2, d2av1e3
   automatically matched to d1akja2
   complexed with gol, scn; mutant

Details for d2av1d2

PDB Entry: 2av1, 1.95 Å

PDB Description: crystal structure of htlv-1 tax peptide bound to human class i mhc hla-a2 with the e63q and k66a mutations in the heavy chain.

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2av1d2:

Sequence; same for both SEQRES and ATOM records:

>d2av1d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgqtravkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2av1d2:

• d2av1d2 first appeared in SCOP 1.73
  
• d2av1d2 appears in SCOPe 2.07