Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
Domain d2av1d1: 2av1 D:182-275 [127352] Other proteins in same PDB: d2av1a2, d2av1b1, d2av1d2, d2av1e1 automatically matched to d1akja1 complexed with gol, scn; mutant |
PDB Entry: 2av1 (more details), 1.95 Å
SCOP Domain Sequences for d2av1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av1d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d2av1d1:
View in 3D Domains from other chains: (mouse over for more information) d2av1a1, d2av1a2, d2av1b1, d2av1e1 |