Lineage for d2av1d1 (2av1 D:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654588Domain d2av1d1: 2av1 D:182-275 [127352]
    Other proteins in same PDB: d2av1a2, d2av1b1, d2av1d2, d2av1e1
    automatically matched to d1akja1
    complexed with gol, scn; mutant

Details for d2av1d1

PDB Entry: 2av1 (more details), 1.95 Å

PDB Description: crystal structure of htlv-1 tax peptide bound to human class i mhc hla-a2 with the e63q and k66a mutations in the heavy chain.
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2av1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av1d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d2av1d1:

Click to download the PDB-style file with coordinates for d2av1d1.
(The format of our PDB-style files is described here.)

Timeline for d2av1d1: