SCOP 1.73: Domain d2av0b1: 2av0 B:2-146

Lineage for d2av0b1 (2av0 B:2-146)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)

8. Domain d2av0b1: 2av0 B:2-146 [127348]
   automatically matched to d2hbia_
   complexed with cmo, hem; mutant

Details for d2av0b1

PDB Entry: 2av0, 1.5 Å

PDB Description: f97l with co bound

PDB Compounds: (B:) Globin I

SCOP Domain Sequences for d2av0b1:

Sequence; same for both SEQRES and ATOM records:

>d2av0b1 a.1.1.2 (B:2-146) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvveklavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2av0b1:

• d2av0b1 is new in SCOP 1.73
  
• d2av0b1 appears in SCOP 1.75
  
• d2av0b1 appears in the current release, SCOPe 2.08, called d2av0b_