Lineage for d2auwb1 (2auw B:88-155)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322904Family a.35.1.10: NE0471 C-terminal domain-like [140523] (1 protein)
  6. 2322905Protein Hypothetical protein NE0471 C-terminal domain [140524] (1 species)
  7. 2322906Species Nitrosomonas europaea [TaxId:915] [140525] (1 PDB entry)
    Uniprot Q82X29 88-154
  8. 2322908Domain d2auwb1: 2auw B:88-155 [127341]
    Other proteins in same PDB: d2auwa2, d2auwb2
    automated match to d2auwa1
    complexed with fmt, gol

Details for d2auwb1

PDB Entry: 2auw (more details), 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718
PDB Compounds: (B:) hypothetical protein NE0471

SCOPe Domain Sequences for d2auwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2auwb1 a.35.1.10 (B:88-155) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]}
vshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclgweatrpetk
tlprtlpa

SCOPe Domain Coordinates for d2auwb1:

Click to download the PDB-style file with coordinates for d2auwb1.
(The format of our PDB-style files is described here.)

Timeline for d2auwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2auwb2