SCOP 1.73: Domain d2auua1: 2auu A:1-175

Lineage for d2auua1 (2auu A:1-175)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (6 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Escherichia coli [TaxId:562] [50329] (17 PDB entries)

8. Domain d2auua1: 2auu A:1-175 [127338]
   automatically matched to d1i40a_
   complexed with cl, f, mg, na, pop

Details for d2auua1

PDB Entry: 2auu, 1.22 Å

PDB Description: inorganic pyrophosphatase complexed with magnesium pyrophosphate and fluoride

PDB Compounds: (A:) inorganic pyrophosphatase

SCOP Domain Sequences for d2auua1:

Sequence; same for both SEQRES and ATOM records:

>d2auua1 b.40.5.1 (A:1-175) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

Timeline for d2auua1:

• d2auua1 is new in SCOP 1.73
  
• d2auua1 appears in SCOP 1.75
  
• d2auua1 appears in the current release, SCOPe 2.08, called d2auua_