| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein) N-terminal half of Pfam PF02016 |
| Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries) Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169 |
| Domain d2auma2: 2aum A:5-142 [127331] Other proteins in same PDB: d2auma1, d2aumb1 mutant |
PDB Entry: 2aum (more details), 2.4 Å
SCOPe Domain Sequences for d2auma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2auma2 c.23.16.7 (A:5-142) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfadisvllsaf
hrhglpaihgpvatglgl
Timeline for d2auma2: