Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56163] (8 PDB entries) |
Domain d2auha1: 2auh A:987-1283 [127329] automatically matched to d1rqqa_ complexed with ca |
PDB Entry: 2auh (more details), 3.2 Å
SCOP Domain Sequences for d2auha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2auha1 d.144.1.7 (A:987-1283) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
Timeline for d2auha1: