SCOPe 2.08: Domain d2auab1: 2aua B:2-195

Lineage for d2auab1 (2aua B:2-195)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.6: BC2332-like [143947] (1 protein)
   minimized common structural core with two large, mainly helical insertions on one side forming dimerization "domain"

6. Protein Hypothetical protein BC2332 [143948] (1 species)

7. Species Bacillus cereus [TaxId:1396] [143949] (1 PDB entry)
   Uniprot Q81DM5 2-195

8. Domain d2auab1: 2aua B:2-195 [127327]
   Other proteins in same PDB: d2auaa2, d2auab2
   automatically matched to 2AUA A:2-195

Details for d2auab1

PDB Entry: 2aua, 2.35 Å

PDB Description: structure of bc2332: a protein of unknown function from bacillus cereus

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2auab1:

Sequence, based on SEQRES records:

>d2auab1 d.166.1.6 (B:2-195) Hypothetical protein BC2332 {Bacillus cereus [TaxId: 1396]}
netefyayhivtrkkmhigqmipfnknqhntlyhfffereqlnangedgiqilnnhyknd
elhinnenakvvisymdqtiraaretivemvrlqefpeypsrlsclyaaksyedalkwka
lfdsynrevlqivklrvigssfegdgnllpkedgipfsqkieqarkywkgnirnelpell
ingeievveiiddf

Sequence, based on observed residues (ATOM records):

>d2auab1 d.166.1.6 (B:2-195) Hypothetical protein BC2332 {Bacillus cereus [TaxId: 1396]}
netefyayhivtrkkmhigqmipfnqhntlyhfffereqlnangedgiqilnnhykndel
hinnenakvvisymdqtiraaretivemvrlqefpeypsrlsclyaaksyedalkwkalf
dsynrevlqivklrvigssfegdgnllpkedgipfsqkieqarkywkgnelpellingei
evveiiddf

Timeline for d2auab1:

• d2auab1 first appeared in SCOP 1.73
  
• d2auab1 appears in SCOPe 2.07