Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.6: BC2332-like [143947] (1 protein) minimized common structural core with two large, mainly helical insertions on one side forming dimerization "domain" |
Protein Hypothetical protein BC2332 [143948] (1 species) |
Species Bacillus cereus [TaxId:1396] [143949] (1 PDB entry) Uniprot Q81DM5 2-195 |
Domain d2auaa1: 2aua A:2-195 [127326] Other proteins in same PDB: d2auaa2, d2auab2 |
PDB Entry: 2aua (more details), 2.35 Å
SCOPe Domain Sequences for d2auaa1:
Sequence, based on SEQRES records: (download)
>d2auaa1 d.166.1.6 (A:2-195) Hypothetical protein BC2332 {Bacillus cereus [TaxId: 1396]} netefyayhivtrkkmhigqmipfnknqhntlyhfffereqlnangedgiqilnnhyknd elhinnenakvvisymdqtiraaretivemvrlqefpeypsrlsclyaaksyedalkwka lfdsynrevlqivklrvigssfegdgnllpkedgipfsqkieqarkywkgnirnelpell ingeievveiiddf
>d2auaa1 d.166.1.6 (A:2-195) Hypothetical protein BC2332 {Bacillus cereus [TaxId: 1396]} netefyayhivtrkkmhigqmipfnknqhntlyhfffereqlnangedgiqilnnhyknd elhinnenakvvisymdqtiraaretivemvrlqefpeypsrlsclyaaksyedalkwka lfdsynrevlqivklrvigssfegdgnllpkedgipfsqkieqarkywkgnnelpellin geievveiiddf
Timeline for d2auaa1: