Lineage for d2au6a1 (2au6 A:1-175)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668738Superfamily b.40.5: Inorganic pyrophosphatase [50324] (1 family) (S)
  5. 668739Family b.40.5.1: Inorganic pyrophosphatase [50325] (1 protein)
    barrel, closed; n=5, S=8
  6. 668740Protein Inorganic pyrophosphatase [50326] (6 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 668779Species Escherichia coli [TaxId:562] [50329] (17 PDB entries)
  8. 668781Domain d2au6a1: 2au6 A:1-175 [127323]
    automatically matched to d1i40a_
    complexed with cl, f, mn, na, po4, pop

Details for d2au6a1

PDB Entry: 2au6 (more details), 1.2 Å

PDB Description: Crystal structure of catalytic intermediate of inorganic pyrophosphatase
PDB Compounds: (A:) inorganic pyrophosphatase

SCOP Domain Sequences for d2au6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2au6a1 b.40.5.1 (A:1-175) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

SCOP Domain Coordinates for d2au6a1:

Click to download the PDB-style file with coordinates for d2au6a1.
(The format of our PDB-style files is described here.)

Timeline for d2au6a1: