![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) ![]() |
![]() | Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Inorganic pyrophosphatase [50326] (9 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
![]() | Species Escherichia coli [TaxId:562] [50329] (19 PDB entries) |
![]() | Domain d2au6a_: 2au6 A: [127323] automated match to d1i40a_ complexed with cl, f, mn, na, po4, pop |
PDB Entry: 2au6 (more details), 1.2 Å
SCOPe Domain Sequences for d2au6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2au6a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]} sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
Timeline for d2au6a_: