Lineage for d2au0b1 (2au0 B:1241-1341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:2287] [255037] (2 PDB entries)
  8. 3008529Domain d2au0b1: 2au0 B:1241-1341 [127320]
    Other proteins in same PDB: d2au0a2, d2au0a3, d2au0b2, d2au0b3
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca

Details for d2au0b1

PDB Entry: 2au0 (more details), 2.7 Å

PDB Description: Unmodified preinsertion binary complex
PDB Compounds: (B:) Dpo4 polymerase IV

SCOPe Domain Sequences for d2au0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2au0b1 d.240.1.0 (B:1241-1341) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d2au0b1:

Click to download the PDB-style file with coordinates for d2au0b1.
(The format of our PDB-style files is described here.)

Timeline for d2au0b1: