| Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
| Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
| Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
| Protein automated matches [231300] (4 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [255036] (2 PDB entries) |
| Domain d2au0a2: 2au0 A:2-240 [127319] Other proteins in same PDB: d2au0a1, d2au0a3, d2au0b1, d2au0b3 automated match to d1jx4a2 protein/DNA complex; complexed with ca |
PDB Entry: 2au0 (more details), 2.7 Å
SCOPe Domain Sequences for d2au0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2au0a2 e.8.1.7 (A:2-240) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d2au0a2: