SCOPe 2.08: Domain d2au0a1: 2au0 A:241-341

Lineage for d2au0a1 (2au0 A:241-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255037] (2 PDB entries)

8. Domain d2au0a1: 2au0 A:241-341 [127318]
   Other proteins in same PDB: d2au0a2, d2au0a3, d2au0b2, d2au0b3
   automated match to d1jx4a1
   protein/DNA complex; complexed with ca

Details for d2au0a1

PDB Entry: 2au0, 2.7 Å

PDB Description: Unmodified preinsertion binary complex

PDB Compounds: (A:) Dpo4 polymerase IV

SCOPe Domain Sequences for d2au0a1:

Sequence; same for both SEQRES and ATOM records:

>d2au0a1 d.240.1.0 (A:241-341) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2au0a1:

• d2au0a1 first appeared in SCOP 1.73
  
• d2au0a1 appears in SCOPe 2.07