![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.264: Prim-pol domain [56746] (1 superfamily) consists of two alpha+beta domains |
![]() | Superfamily d.264.1: Prim-pol domain [56747] (3 families) ![]() |
![]() | Family d.264.1.3: HP0184-like [143897] (1 protein) stand-alone domain with the least decorated Prim-pol fold |
![]() | Protein Hypothetical protein HP0184 [143898] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [143899] (1 PDB entry) Uniprot O24984 3-178 |
![]() | Domain d2atza1: 2atz A:3-178 [127317] complexed with dgt, edo |
PDB Entry: 2atz (more details), 2 Å
SCOPe Domain Sequences for d2atza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atza1 d.264.1.3 (A:3-178) Hypothetical protein HP0184 {Helicobacter pylori [TaxId: 210]} emelklikidtshyfekkpglgervdyagrcfynkfqrvnamltssliqkhlkreieiah nlilrndkvenivfdyngrnperfyhkaqlllreegfmnftayntktpghlhlyvhkght elgegerlvktlsmklaqglpkewkvfpsnewpkefnilalpyevfakergsswak
Timeline for d2atza1: