SCOPe 2.08: Domain d2atxb_: 2atx B:

Lineage for d2atxb_ (2atx B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoQ [142261] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142262] (1 PDB entry)
   Uniprot P17081 1-185

8. Domain d2atxb_: 2atx B: [127316]
   automated match to d2atxa1
   complexed with gnp, mg

Details for d2atxb_

PDB Entry: 2atx, 2.65 Å

PDB Description: crystal structure of the tc10 gppnhp complex

PDB Compounds: (B:) small GTP binding protein TC10

SCOPe Domain Sequences for d2atxb_:

Sequence; same for both SEQRES and ATOM records:

>d2atxb_ c.37.1.8 (B:) RhoQ {Human (Homo sapiens) [TaxId: 9606]}
smahgpgalmlkcvvvgdgavgktcllmsyandafpeeyvptvfdhyavsvtvggkqyll
glydtagqedydrlrplsypmtdvflicfsvvnpasfqnvkeewvpelkeyapnvpflli
gtqidlrddpktlarlndmkekpicveqgqklakeigaccyvecsaltqkglktvfdeai
iailtp

Timeline for d2atxb_:

• d2atxb_ first appeared in SCOP 1.73, called d2atxb1
  
• d2atxb_ appears in SCOPe 2.07