SCOPe 2.07: Domain d2atwc3: 2atw C:263-329

Lineage for d2atwc3 (2atw C:263-329)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
   duplication: tandem repeat of two type II KH-domains

7. Species Mycobacterium tuberculosis [TaxId:1773] [69703] (3 PDB entries)

8. Domain d2atwc3: 2atw C:263-329 [127314]
   Other proteins in same PDB: d2atwa1, d2atwc1
   automatically matched to d1k0ra3
   protein/RNA complex

Details for d2atwc3

PDB Entry: 2atw, 2.25 Å

PDB Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex

PDB Compounds: (C:) Transcription elongation protein nusA

SCOPe Domain Sequences for d2atwc3:

Sequence; same for both SEQRES and ATOM records:

>d2atwc3 d.52.3.1 (C:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}
dparfvanalspakvvsvsvidqtaraarvvvpdfqlslaigkegqnarlaarltgwrid
irgdapp

Timeline for d2atwc3:

• d2atwc3 first appeared in SCOP 1.73
  
• d2atwc3 appears in SCOPe 2.06
  
• d2atwc3 appears in the current release, SCOPe 2.08