| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
| Protein Transcription factor NusA, C-terminal domains [69701] (2 species) duplication: tandem repeat of two type II KH-domains |
| Species Mycobacterium tuberculosis [TaxId:1773] [69703] (3 PDB entries) |
| Domain d2atwc2: 2atw C:184-262 [127313] Other proteins in same PDB: d2atwa1, d2atwc1 automatically matched to d1k0ra2 |
PDB Entry: 2atw (more details), 2.25 Å
SCOP Domain Sequences for d2atwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atwc2 d.52.3.1 (C:184-262) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]}
thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
rnvmselsgekidiidydd
Timeline for d2atwc2: