![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Transcription factor NusA, C-terminal domains [69701] (2 species) duplication: tandem repeat of two type II KH-domains |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [69703] (3 PDB entries) |
![]() | Domain d2atwa2: 2atw A:184-262 [127310] Other proteins in same PDB: d2atwa1, d2atwc1 automatically matched to d1k0ra2 protein/RNA complex |
PDB Entry: 2atw (more details), 2.25 Å
SCOPe Domain Sequences for d2atwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atwa2 d.52.3.1 (A:184-262) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv rnvmselsgekidiidydd
Timeline for d2atwa2: