SCOPe 2.08: Domain d2atwa1: 2atw A:108-183

Lineage for d2atwa1 (2atw A:108-183)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein S1 domain of NusA [69265] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries)

8. Domain d2atwa1: 2atw A:108-183 [127309]
   Other proteins in same PDB: d2atwa2, d2atwa3, d2atwc2, d2atwc3
   automatically matched to d1k0ra1
   protein/RNA complex

Details for d2atwa1

PDB Entry: 2atw, 2.25 Å

PDB Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex

PDB Compounds: (A:) Transcription elongation protein nusA

SCOPe Domain Sequences for d2atwa1:

Sequence; same for both SEQRES and ATOM records:

>d2atwa1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr

Timeline for d2atwa1:

• d2atwa1 first appeared in SCOP 1.73
  
• d2atwa1 appears in SCOPe 2.07