Lineage for d2atra1 (2atr A:1-137)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731223Protein Probable acetyltransferase SP0256 [143680] (1 species)
    probable SA2161 ortholog
  7. 731224Species Streptococcus pneumoniae [TaxId:1313] [143681] (1 PDB entry)
  8. 731225Domain d2atra1: 2atr A:1-137 [127305]

Details for d2atra1

PDB Entry: 2atr (more details), 2.01 Å

PDB Description: Acetyltransferase, GNAT family protein SP0256 from Streptococcus pneumoniae TIGR4
PDB Compounds: (A:) acetyltransferase, GNAT family

SCOP Domain Sequences for d2atra1:

Sequence, based on SEQRES records: (download)

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}
mitikkqeivkledvlhlyqavgwtnythqtemleqalshslviylaldgdavvglirlv
gdgfssvfvqdlivlpsyqrqgigsslmkealgnfkeayqvqlateeteknvgfyrsmgf
eilstydctgmiwinre

Sequence, based on observed residues (ATOM records): (download)

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}
mitikkqeivkledvlhlyqavgwtnemleqalshslviylaldgdavvglirlvgdgfs
svfvqdlivlpsyqrqgigsslmkealgnfkeayqvqlateeteknvgfyrsmgfeilst
ydctgmiwinre

SCOP Domain Coordinates for d2atra1:

Click to download the PDB-style file with coordinates for d2atra1.
(The format of our PDB-style files is described here.)

Timeline for d2atra1: