Lineage for d2atpa_ (2atp A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021515Protein CD8 [48734] (3 species)
  7. 2021524Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 2021527Domain d2atpa_: 2atp A: [127301]
    automated match to d1bqhh_
    complexed with nag

Details for d2atpa_

PDB Entry: 2atp (more details), 2.4 Å

PDB Description: crystal structure of a cd8ab heterodimer
PDB Compounds: (A:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2atpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atpa_ b.1.1.1 (A:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

SCOPe Domain Coordinates for d2atpa_:

Click to download the PDB-style file with coordinates for d2atpa_.
(The format of our PDB-style files is described here.)

Timeline for d2atpa_: