Lineage for d2atlb2 (2atl B:1002-1240)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018090Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3018195Protein automated matches [231300] (5 species)
    not a true protein
  7. 3018210Species Sulfolobus solfataricus [TaxId:2287] [255036] (2 PDB entries)
  8. 3018212Domain d2atlb2: 2atl B:1002-1240 [127299]
    Other proteins in same PDB: d2atla1, d2atla3, d2atlb1, d2atlb3
    automated match to d1jx4a2
    protein/DNA complex; complexed with ca, dcp

Details for d2atlb2

PDB Entry: 2atl (more details), 2.8 Å

PDB Description: Unmodified Insertion Ternary Complex
PDB Compounds: (B:) Dpo4 polymerase IV

SCOPe Domain Sequences for d2atlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atlb2 e.8.1.7 (B:1002-1240) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi
veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea
ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia
dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOPe Domain Coordinates for d2atlb2:

Click to download the PDB-style file with coordinates for d2atlb2.
(The format of our PDB-style files is described here.)

Timeline for d2atlb2: