SCOPe 2.08: Domain d2atlb1: 2atl B:1241-1341

Lineage for d2atlb1 (2atl B:1241-1341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255037] (2 PDB entries)

8. Domain d2atlb1: 2atl B:1241-1341 [127298]
   Other proteins in same PDB: d2atla2, d2atla3, d2atlb2, d2atlb3
   automated match to d1jx4a1
   protein/DNA complex; complexed with ca, dcp

Details for d2atlb1

PDB Entry: 2atl, 2.8 Å

PDB Description: Unmodified Insertion Ternary Complex

PDB Compounds: (B:) Dpo4 polymerase IV

SCOPe Domain Sequences for d2atlb1:

Sequence; same for both SEQRES and ATOM records:

>d2atlb1 d.240.1.0 (B:1241-1341) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2atlb1:

• d2atlb1 first appeared in SCOP 1.73
  
• d2atlb1 appears in SCOPe 2.07