Lineage for d2atla1 (2atl A:241-341)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614248Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2614249Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2614349Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 2614350Protein automated matches [231324] (5 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:2287] [255037] (2 PDB entries)
  8. 2614368Domain d2atla1: 2atl A:241-341 [127296]
    Other proteins in same PDB: d2atla2, d2atla3, d2atlb2, d2atlb3
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca, dcp

Details for d2atla1

PDB Entry: 2atl (more details), 2.8 Å

PDB Description: Unmodified Insertion Ternary Complex
PDB Compounds: (A:) Dpo4 polymerase IV

SCOPe Domain Sequences for d2atla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atla1 d.240.1.0 (A:241-341) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d2atla1:

Click to download the PDB-style file with coordinates for d2atla1.
(The format of our PDB-style files is described here.)

Timeline for d2atla1: