Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (2 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [186922] (9 PDB entries) |
Domain d2atkc_: 2atk C: [127295] Other proteins in same PDB: d2atka1, d2atka2, d2atkb1, d2atkb2 automated match to d2p7tc_ complexed with f09, k; mutant |
PDB Entry: 2atk (more details), 2.5 Å
SCOPe Domain Sequences for d2atkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atkc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2atkc_:
View in 3D Domains from other chains: (mouse over for more information) d2atka1, d2atka2, d2atkb1, d2atkb2 |