Lineage for d2atkc1 (2atk C:86-119)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058900Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1058901Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1058902Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1058919Protein Potassium channel protein [56901] (2 species)
  7. 1058920Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1058934Domain d2atkc1: 2atk C:86-119 [127295]
    automatically matched to d1jq1a_
    complexed with f09, k; mutant

Details for d2atkc1

PDB Entry: 2atk (more details), 2.5 Å

PDB Description: structure of a mutant kcsa k+ channel
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2atkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atkc1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d2atkc1:

Click to download the PDB-style file with coordinates for d2atkc1.
(The format of our PDB-style files is described here.)

Timeline for d2atkc1: