Lineage for d2atib1 (2ati B:23-830)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709765Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 709766Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (9 families) (S)
  5. 709818Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 709819Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 709839Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (86 PDB entries)
  8. 709862Domain d2atib1: 2ati B:23-830 [127294]
    automatically matched to d1noj__
    complexed with glc, ihu, plp

Details for d2atib1

PDB Entry: 2ati (more details), 1.9 Å

PDB Description: glycogen phosphorylase inhibitors
PDB Compounds: (B:) Glycogen phosphorylase, liver form

SCOP Domain Sequences for d2atib1:

Sequence, based on SEQRES records: (download)

>d2atib1 c.87.1.4 (B:23-830) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
kniaasgkfssdrtikeyaqniwnveps

Sequence, based on observed residues (ATOM records): (download)

>d2atib1 c.87.1.4 (B:23-830) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapdyiqavldrnlae
nisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiqlndt
hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
lhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgskl
kviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvema
eeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkd
iinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikey
aqniwnveps

SCOP Domain Coordinates for d2atib1:

Click to download the PDB-style file with coordinates for d2atib1.
(The format of our PDB-style files is described here.)

Timeline for d2atib1: