SCOP 1.73: Domain d2athb1: 2ath B:207-477

Lineage for d2athb1 (2ath B:207-477)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (25 PDB entries)

8. Domain d2athb1: 2ath B:207-477 [127292]
   automatically matched to d1wm0x_
   complexed with 3ea

Details for d2athb1

PDB Entry: 2ath, 2.28 Å

PDB Description: Crystal structure of the ligand binding domain of human PPAR-gamma im complex with an agonist

PDB Compounds: (B:) Peroxisome proliferator activated receptor gamma

SCOP Domain Sequences for d2athb1:

Sequence; same for both SEQRES and ATOM records:

>d2athb1 a.123.1.1 (B:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Timeline for d2athb1:

• d2athb1 is new in SCOP 1.73
  
• d2athb1 appears in SCOP 1.75
  
• d2athb1 appears in the current release, SCOPe 2.08, called d2athb_