SCOPe 2.08: Domain d2athb_: 2ath B:

Lineage for d2athb_ (2ath B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d2athb_: 2ath B: [127292]
   automated match to d1fm6d_
   complexed with 3ea

Details for d2athb_

PDB Entry: 2ath, 2.28 Å

PDB Description: Crystal structure of the ligand binding domain of human PPAR-gamma im complex with an agonist

PDB Compounds: (B:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d2athb_:

Sequence; same for both SEQRES and ATOM records:

>d2athb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Timeline for d2athb_:

• d2athb_ first appeared in SCOP 1.73, called d2athb1
  
• d2athb_ appears in SCOPe 2.07