Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
Domain d2atha_: 2ath A: [127291] automated match to d1fm6d_ complexed with 3ea |
PDB Entry: 2ath (more details), 2.28 Å
SCOPe Domain Sequences for d2atha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2atha_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv tehvqllqvikktetdmslhpllqeiykdly
Timeline for d2atha_: