Lineage for d2atfa1 (2atf A:5-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330857Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1330858Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1330861Species Mouse (Mus musculus) [TaxId:10090] [141617] (2 PDB entries)
    Uniprot P60334 5-190
  8. 1330862Domain d2atfa1: 2atf A:5-190 [127290]
    complexed with edo, ni

Details for d2atfa1

PDB Entry: 2atf (more details), 1.75 Å

PDB Description: x-ray structure of cysteine dioxygenase type i from mus musculus mm.241056
PDB Compounds: (A:) Cysteine dioxygenase type I

SCOPe Domain Sequences for d2atfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atfa1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d2atfa1:

Click to download the PDB-style file with coordinates for d2atfa1.
(The format of our PDB-style files is described here.)

Timeline for d2atfa1: