Lineage for d2atea1 (2ate A:8-169)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692273Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 692274Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 692275Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 692292Species Escherichia coli [TaxId:562] [52258] (3 PDB entries)
  8. 692294Domain d2atea1: 2ate A:8-169 [127289]
    automatically matched to d1qcza_
    complexed with nia

Details for d2atea1

PDB Entry: 2ate (more details), 1.8 Å

PDB Description: Structure of the complex of PurE with NitroAIR
PDB Compounds: (A:) Phosphoribosylaminoimidazole carboxylase catalytic subunit

SCOP Domain Sequences for d2atea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atea1 c.23.8.1 (A:8-169) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]}
arvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvii
agaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkagaa
naallaaqilathdkelhqrlndwrkaqtdevlenpdprgaa

SCOP Domain Coordinates for d2atea1:

Click to download the PDB-style file with coordinates for d2atea1.
(The format of our PDB-style files is described here.)

Timeline for d2atea1: