SCOPe 2.08: Domain d2at8x_: 2at8 X:

Lineage for d2at8x_ (2at8 X:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
   Uniprot Q94734 22-205

8. Domain d2at8x_: 2at8 X: [127284]
   automated match to d1d2ua_
   complexed with fdd, no, po4

Details for d2at8x_

PDB Entry: 2at8, 1 Å

PDB Description: 0.96 A Crystal Structure Of Nitrophorin 4 From Rhodnius Prolixus Containing Fe(III) 2,4 Dimethyl Deuteroporphyrin IX Complexed With Nitric Oxide at pH 5.6

PDB Compounds: (X:) Nitrophorin 4

SCOPe Domain Sequences for d2at8x_:

Sequence; same for both SEQRES and ATOM records:

>d2at8x_ b.60.1.1 (X:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d2at8x_:

• d2at8x_ first appeared in SCOP 1.73, called d2at8x1
  
• d2at8x_ appears in SCOPe 2.07