![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Nitrophorin 4 [50845] (1 species) |
![]() | Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries) Uniprot Q94734 22-205 |
![]() | Domain d2at8x_: 2at8 X: [127284] automated match to d1d2ua_ complexed with fdd, no, po4 |
PDB Entry: 2at8 (more details), 1 Å
SCOPe Domain Sequences for d2at8x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2at8x_ b.60.1.1 (X:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d2at8x_: