Lineage for d2asyb1 (2asy B:1-101)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723903Family d.58.4.12: Hypothetical protein YdhR [117940] (1 protein)
  6. 723904Protein Hypothetical protein YdhR [117941] (1 species)
  7. 723905Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
  8. 723910Domain d2asyb1: 2asy B:1-101 [127279]
    automatically matched to 2ASY A:1-101

Details for d2asyb1

PDB Entry: 2asy (more details)

PDB Description: Solution Structure of ydhR protein from Escherichia coli
PDB Compounds: (B:) Protein ydhR precursor

SCOP Domain Sequences for d2asyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asyb1 d.58.4.12 (B:1-101) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdek
salaylekhtarlknlgveevvakvfdvneplsqinqakla

SCOP Domain Coordinates for d2asyb1:

Click to download the PDB-style file with coordinates for d2asyb1.
(The format of our PDB-style files is described here.)

Timeline for d2asyb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2asya1