Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein CksHs1 [55645] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55646] (5 PDB entries) |
Domain d2assc1: 2ass C:3005-3073 [127272] Other proteins in same PDB: d2assb1, d2assb2 automatically matched to d1dksa_ complexed with ben, po4 |
PDB Entry: 2ass (more details), 3 Å
SCOPe Domain Sequences for d2assc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2assc1 d.97.1.1 (C:3005-3073) CksHs1 {Human (Homo sapiens) [TaxId: 9606]} qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep hillfrrpl
Timeline for d2assc1: