Lineage for d2asqa1 (2asq A:21-97)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017711Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1017717Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries)
    Uniprot Q93068
  8. 1017730Domain d2asqa1: 2asq A:21-97 [127269]
    automatically matched to d1tgzb_

Details for d2asqa1

PDB Entry: 2asq (more details)

PDB Description: Solution Structure of SUMO-1 in Complex with a SUMO-binding Motif (SBM)
PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2asqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asqa1 d.15.1.1 (A:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

SCOPe Domain Coordinates for d2asqa1:

Click to download the PDB-style file with coordinates for d2asqa1.
(The format of our PDB-style files is described here.)

Timeline for d2asqa1: