Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DinB homolog (DBH) [100889] (3 species) |
Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (41 PDB entries) |
Domain d2asla2: 2asl A:2-240 [127259] Other proteins in same PDB: d2asla1, d2asla3, d2aslb1, d2aslb3 automated match to d1jx4a2 protein/DNA complex; complexed with ca |
PDB Entry: 2asl (more details), 2.65 Å
SCOPe Domain Sequences for d2asla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asla2 e.8.1.7 (A:2-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} ivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagipi veakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyrea ynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldia dvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d2asla2: