SCOPe 2.06: Domain d2asja1: 2asj A:241-341

Lineage for d2asja1 (2asj A:241-341)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d2asja1: 2asj A:241-341 [127254]
   Other proteins in same PDB: d2asja2, d2asja3, d2asjb2, d2asjb3
   automated match to d1jx4a1
   protein/DNA complex; complexed with ca

Details for d2asja1

PDB Entry: 2asj, 2.35 Å

PDB Description: oxoG-modified Preinsertion Binary Complex

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2asja1:

Sequence; same for both SEQRES and ATOM records:

>d2asja1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2asja1:

• d2asja1 first appeared in SCOP 1.73
  
• d2asja1 appears in SCOPe 2.05
  
• d2asja1 appears in SCOPe 2.07
  
• d2asja1 appears in the current release, SCOPe 2.08